PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK28617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 511aa    MW: 59163.9 Da    PI: 7.9934
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK28617.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.89.3e-12294336346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eE+++l  av++ G ++W ++a+ ++ gR + qc ++w  
       KFK28617.1 294 EWTPEEEDQLRVAVELIGEKNWPAVANVLQ-GRNRSQCSNKWKE 336
                      7*****************************.***********75 PP

2Myb_DNA-binding37.36.5e-12350394146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+rW+ +E e+l+ a + +G ++W++Iar ++ gRt+ qc  +w  
       KFK28617.1 350 RKRWSSQEVERLKIAMTFFGAENWHRIARFIP-GRTDSQCSAKWKE 394
                      89******************************.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.122168258IPR017877Myb-like domain
SMARTSM007176.8172260IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-5242293IPR009057Homeodomain-like
PROSITE profilePS500904.298264292IPR017877Myb-like domain
SMARTSM007173.3E-10291340IPR001005SANT/Myb domain
PROSITE profilePS5129412.145293342IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-12294336IPR009057Homeodomain-like
PfamPF002493.3E-11294336IPR001005SANT/Myb domain
CDDcd001671.04E-8294338No hitNo description
SuperFamilySSF466892.58E-10294339IPR009057Homeodomain-like
PROSITE profilePS5129415.551346400IPR017930Myb domain
SuperFamilySSF466892.4E-15348410IPR009057Homeodomain-like
SMARTSM007171.5E-7349398IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-17352414IPR009057Homeodomain-like
CDDcd001672.36E-7352396No hitNo description
PfamPF139211.1E-10353413No hitNo description
PROSITE profilePS500904.437397447IPR017877Myb-like domain
SMARTSM0071785401461IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MLRRIKNQLE LAIDEEDEDD SAFETLCATP SRFYAYVKLN DVQGNVMNDS PAKKKNQITG  60
NRRTQQCKIQ SKNYMKILPL ISLLYKLRVS LNLHKPLLMQ SGRTDFQASC KRITKQALSQ  120
SKDPRIELIS TPKCSSKVTD KKTSSPLTLG PPENSSVAIY KMAFEKYSFS VDRKNWTQKE  180
NENLAKGLKH QLQETLIREA TDDLEGSLDD IDTILEGIKN LEITPEMIRQ FLPKVHWDQL  240
DIKNRSAAEC EARWMSTEDP MINNSSTWTK AEDDYIRLVT ENKSYTDWLD IASEWTPEEE  300
DQLRVAVELI GEKNWPAVAN VLQGRNRSQC SNKWKECKER KGWSCRQKIR KRWSSQEVER  360
LKIAMTFFGA ENWHRIARFI PGRTDSQCSA KWKETLDHRV NHGKWTEEEN AKLLEATKEN  420
GVERPDLAIE DFLELAAISL EQEQSRTIAP KKKRKERQKK SDGAATERQP KRRRKGYLER  480
SLGDVCSRQE NENVCENIEA NNEGELCDQE A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-122934287136MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-122934287136MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1449455PKKKRKE
2452474KRKERQKKSDGAATERQPKRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867927.11e-146hypothetical protein ARALYDRAFT_354789
TrEMBLA0A087GFG50.0A0A087GFG5_ARAAL; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_70019621e-146(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.31e-136myb domain protein 4r1